PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004514305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 550aa    MW: 60970.6 Da    PI: 4.6006
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004514305.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-163986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed++lv++vk+ G g+W+++ +  g+ R++k+c++rw ++l
   XP_004514305.1 39 KGPWTSAEDDILVNYVKKNGEGNWNAVQKQTGLLRCGKSCRLRWANHL 86
                     79******************************99**********9986 PP

2Myb_DNA-binding46.67.7e-1592135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++ +eE++l+++++ +lG++ W++ a+ ++ gRt++++k++w++
   XP_004514305.1  92 KGAFNAEEELLIAELHSKLGNR-WARMAAQLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6823486IPR017930Myb domain
SuperFamilySSF466898.59E-2838133IPR009057Homeodomain-like
SMARTSM007174.7E-133888IPR001005SANT/Myb domain
PfamPF002492.1E-143986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-214092IPR009057Homeodomain-like
CDDcd001674.80E-104186No hitNo description
PROSITE profilePS5129421.72587141IPR017930Myb domain
SMARTSM007171.3E-1491139IPR001005SANT/Myb domain
PfamPF002498.8E-1492135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2293139IPR009057Homeodomain-like
CDDcd001674.67E-1094135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MMRRMKKEIE DGMLLNDHTE PQLNDEGYEG SVCGVVLKKG PWTSAEDDIL VNYVKKNGEG  60
NWNAVQKQTG LLRCGKSCRL RWANHLRPNL KKGAFNAEEE LLIAELHSKL GNRWARMAAQ  120
LPGRTDNEIK NYWNTRVKRC QRAGLPVYPP GVQQETPRDQ STGGINGDHK LHPDFLQKKS  180
YDDIHDAIFD SLKDNQGILP YVPELCDISA YGNMLNGFDS YQYCSFLPAT SNHKILLEST  240
MPFLDSSGNN NRSGFYPFDH IQDNTSDNLT QSFGMQSPLD PGLSSHSSMC YSHSLKNGNS  300
STSKPFEAVK LELPSLQYSE IDLGSWGTSS TPPLLESIED FIQSDTPIST LESDCSSPQN  360
SGLLDALLYP AKTLGSSKNN FYDKCSNSSI ATPGDRADSS ALNMYEPEWE EYADPVPPFG  420
ASSILNEFPA VSANRNSLDE QPPVQNFDGN IVKSEYADQI WTPDSENQIM SLLINSRPDF  480
LLASDWYEPA SGQLTNQSIA TDATSPFLGD HLATDNKHMT AGTSISNHVW EFGSCAWNNM  540
PAVCHMSDLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29371395106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514305.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_004514307.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012575292.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A072TNU80.0A0A072TNU8_MEDTR; Myb transcription factor
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-112myb domain protein 33